PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00007249-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 146aa    MW: 16886 Da    PI: 8.8986
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00007249-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1664107247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         WT+eE+ ++++a k++G   W++I  +mg ++t  q++s+ qk+
  PSME_00007249-RA  64 EIWTEEEHHKFLEALKMHGQA-WRRIEDHMG-TKTTVQIRSHAQKF 107
                       56*****************99.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-1557110IPR009057Homeodomain-like
PROSITE profilePS5129418.60958112IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-960108IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-1561110IPR006447Myb domain, plants
SMARTSM007172.8E-1062110IPR001005SANT/Myb domain
CDDcd001675.89E-966108No hitNo description
PfamPF002494.5E-1466106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
SFVQGEITEA PAGQQGIQSN DVHHSEPSKS QTPSIRFSSD EVSSSGDEFT TKVRKPYTIT  60
KQREIWTEEE HHKFLEALKM HGQAWRRIED HMGTKTTVQI RSHAQKFFSK VFFLYGSPMV  120
EKYFLIYSLT AILVIVSFSW RLTSDR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotF4K5X62e-34RVE2_ARATH; Protein REVEILLE 2
TrEMBLA0A0C9S8A21e-49A0A0C9S8A2_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_11910_4056 transcribed RNA sequence
STRINGSi014682m3e-33(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.11e-35MYB_related family protein